DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDP2

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_013275.1 Gene:IDP2 / 850871 SGDID:S000004164 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:68/283 - (24%)
Similarity:114/283 - (40%) Gaps:64/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 YGD----VDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEY--------------- 533
            :||    .|::.   ..|||..         :|...|..|.:..|:|.:|               
Yeast   135 FGDQYKATDVIV---PEEGELR---------LVYKSKSGTHDVDLKVFDYPEHGGVAMMMYNTTD 187

  Fly   534 ------TFQYALAMKRK-KVTAVAESQVMRMSDGLFLRCVREMAAK-YKSKMDQAGIKYEESTMT 590
                  ...:.||::|| .:.:..::.:::..||.|......|.|: ||.|.:..||.||...:.
Yeast   188 SIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWYEHRLID 252

  Fly   591 TVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIFES--VHGTA---- 649
            .:...:::....| ::.:.|..||:.||..|...|.|||..|..:..:|..|||  .|||.    
Yeast   253 DMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHF 316

  Fly   650 -PDIAGKDLA-NPTALLLSSVMMLHYIGLHEHADKI-------EKAVLKTIRDDNIRTMDLG--- 702
             ....||:.: |..|.:.:....:...|..::...:       |.|.:.|:::|.|.|.||.   
Yeast   317 RQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVNTVQEDGIMTKDLALIL 381

  Fly   703 GKAKCS------EYTDALIKNLK 719
            ||::.|      |:.||:...||
Yeast   382 GKSERSAYVTTEEFIDAVESRLK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 66/280 (24%)
IDP2NP_013275.1 nadp_idh_euk 2..409 CDD:129233 68/283 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.