DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and LEU2

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_009911.2 Gene:LEU2 / 850342 SGDID:S000000523 Length:364 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:106/381 - (27%)
Similarity:173/381 - (45%) Gaps:67/381 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PRVITLMPGDGIGPEISMAVIKILEA-----AKTPLIFE-------PVDVTPVLNSQGMTSVPEQ 434
            |:.|.::|||.:|.||:...||:|:|     :.....||       .:|.|.|       .:|::
Yeast     4 PKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGV-------PLPDE 61

  Fly   435 VIESMNRTKVGLKGPLMTPV-GTGFRSLN-----LTLRQLFNLYANIRPCR-------SLPGVET 486
            .:|:..:....|.|.:..|. |||  |:.     |.:|:...||||:|||.       .|..::.
Yeast    62 ALEASKKADAVLLGAVGGPKWGTG--SVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

  Fly   487 VYG-DVDIVTIRENTEGEY---------SGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAM 541
            .:. ..|.|.:||...|.|         .|:........|..::.|||.|:....::.....: .
Yeast   125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPI-W 188

  Fly   542 KRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYD-M 605
            ...|...:|.|::.|       :.|.|..     |.:...:|.:...:.:..:.:|::|...: :
Yeast   189 SLDKANVLASSRLWR-------KTVEETI-----KNEFPTLKVQHQLIDSAAMILVKNPTHLNGI 241

  Fly   606 LVLPNLYGDIISDTCAGLIGGLGLTPSGNV------GTNGAIFESVHGTAPDIAGKDLANPTALL 664
            ::..|::||||||..:.:.|.|||.||.::      .|...::|..||:|||:. |:..||.|.:
Yeast   242 IITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATI 305

  Fly   665 LSSVMMLHY-IGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIKNLK 719
            ||:.|||.. :.|.|....||.|| |.:.|..|||.||||....:|..||:.:.:|
Yeast   306 LSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNSTTEVGDAVAEEVK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 105/378 (28%)
LEU2NP_009911.2 leuB 6..359 CDD:272939 104/376 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S361
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.720

Return to query results.
Submit another query.