DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH-IV

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_174526.2 Gene:IDH-IV / 840142 AraportID:AT1G32480 Length:214 Species:Arabidopsis thaliana


Alignment Length:234 Identity:82/234 - (35%)
Similarity:138/234 - (58%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGL 446
            ||.:|:     |...::.||.::::|.:.|:.||    |.::..:.|..:..:|::|:.:.||.|
plant     2 PRPVTV-----IDSNVTNAVHQVMDAMQAPVYFE----TYIIKGKNMNHLTWEVVDSIRKNKVCL 57

  Fly   447 KGPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTL 511
            .|.:...:..|       .|:..:|:|::..|.:|.|..:.:.:||||.|||||||||:|.||.:
plant    58 NGRVNNSLCGG-------ARKELDLFASLVDCFNLNGQPSRHENVDIVVIRENTEGEYAGREHEV 115

  Fly   512 VNGVVQSIKL-ITRNASLRVAEYTFQYALAMKRKKVTAVAES-QVMRMSDGLFLRCVREMAAKYK 574
            |.||::|.:: :|:..|.|:|:|.|:||...||||||||..: :..:::|..||...:|:|..|.
plant   116 VPGVIESFQVTMTKFWSDRIAKYAFEYAHFSKRKKVTAVHNNGKYEKLADAFFLESCQEVAKMYP 180

  Fly   575 SKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYG 613
            :      |.|.|..:...||.:|:.|:|:|::|.|||||
plant   181 N------ITYNEIGINNCCLQLVEKPERFDVIVTPNLYG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 82/234 (35%)
IDH-IVNP_174526.2 Iso_dh 2..>213 CDD:294303 80/232 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.