DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH-III

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_195290.1 Gene:IDH-III / 829717 AraportID:AT4G35650 Length:368 Species:Arabidopsis thaliana


Alignment Length:346 Identity:161/346 - (46%)
Similarity:224/346 - (64%) Gaps:19/346 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKV 444
            |.||.:||:|||||||.::.||.:::||...|:.||..:|.     ..|..|||:||||:.|.||
plant    36 GAPRTVTLIPGDGIGPLVTGAVEQVMEAMHAPVHFERYEVL-----GNMRKVPEEVIESVKRNKV 95

  Fly   445 GLKGPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEH 509
            .|||.|.||||.|..|||:.||:..:::|::..|.::||:.|.:.:||||.|||||||||||:||
plant    96 CLKGGLATPVGGGVSSLNMQLRKELDIFASLVNCINVPGLVTRHENVDIVVIRENTEGEYSGLEH 160

  Fly   510 TLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYK 574
            .:|.|||:|:|:||:..|.|:|.|.|:||....|||||||.::.:|:::|||||...||:|..| 
plant   161 EVVPGVVESLKVITKFCSERIARYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVAKHY- 224

  Fly   575 SKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNG 639
                 :||.|.|..:...|:.:|..|:::|::|.|||||::|::|.||:.||.|:.|.||||...
plant   225 -----SGITYNEIIVDNCCMQLVAKPEQFDVMVTPNLYGNLIANTAAGIAGGTGVMPGGNVGAEH 284

  Fly   640 AIFESVHGTAPDIAGKD------LANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRT 698
            ||||  .|.:....|.|      .|||.||||||.|||.::.....||::|.||.:.|::...||
plant   285 AIFE--QGASAGNVGNDKMVEQKKANPVALLLSSAMMLRHLRFPTFADRLETAVKQVIKEGKYRT 347

  Fly   699 MDLGGKAKCSEYTDALIKNLK 719
            .||||.....|..||:|..|:
plant   348 KDLGGDCTTQEVVDAVIAALE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 159/341 (47%)
IDH-IIINP_195290.1 PLN00123 8..368 CDD:215065 160/344 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.