DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH1

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_195252.1 Gene:IDH1 / 829679 AraportID:AT4G35260 Length:367 Species:Arabidopsis thaliana


Alignment Length:346 Identity:162/346 - (46%)
Similarity:227/346 - (65%) Gaps:21/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQG-MTSVPEQVIESMNRTK 443
            |.||.:||:|||||||.::.||.:::||...|:.||..||      .| |:.||.:|:||:.:.|
plant    35 GAPRAVTLIPGDGIGPLVTNAVEQVMEAMHAPIFFEKYDV------HGEMSRVPPEVMESIRKNK 93

  Fly   444 VGLKGPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIE 508
            |.|||.|.||||.|..|||:.||:..:|:|::..|.:|||:.|.:.:||||.|||||||||:|:|
plant    94 VCLKGGLKTPVGGGVSSLNVQLRKELDLFASLVNCFNLPGLPTRHENVDIVVIRENTEGEYAGLE 158

  Fly   509 HTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKY 573
            |.:|.|||:|:|:||:..|.|:|:|.|:||....|||||||.::.:|:::|||||...||:|.||
plant   159 HEVVPGVVESLKVITKFCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVAKKY 223

  Fly   574 KSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTN 638
            .|      |.|.|..:...|:.:|..|:::|::|.|||||:::::|.||:.||.|:.|.||||.:
plant   224 PS------ITYNEIIVDNCCMQLVAKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGAD 282

  Fly   639 GAIFESVHGTAPDIAGKD------LANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIR 697
            .|:||  .|.:....|||      .|||.||||||.|||.::.....||::|.||.|.|.:...|
plant   283 HAVFE--QGASAGNVGKDKIVLENKANPVALLLSSAMMLRHLQFPSFADRLETAVKKVIAEGKCR 345

  Fly   698 TMDLGGKAKCSEYTDALIKNL 718
            |.||||.:...|..||:|..|
plant   346 TKDLGGTSTTQEVVDAVIAKL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 160/342 (47%)
IDH1NP_195252.1 PLN00123 8..367 CDD:215065 162/346 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.