DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH-VI

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_850549.1 Gene:IDH-VI / 820139 AraportID:AT3G09810 Length:374 Species:Arabidopsis thaliana


Alignment Length:372 Identity:187/372 - (50%)
Similarity:253/372 - (68%) Gaps:27/372 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 GQGQK---GGAGGKSGK---------ASGEPRVITLMPGDGIGPEISMAVIKILEAAKTPL---- 412
            |.|..   |.:...||.         :|..|...||.|||||||||:.:|.::..||...:    
plant    13 GNGSSQILGTSSSSSGPFISVSRAFFSSSTPIKATLFPGDGIGPEIAESVKQVFTAADVVIDWDE 77

  Fly   413 IFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGPLMTPVGTGFRSLNLTLRQLFNLYANIRP 477
            .|...:|.|..||    .:....::|:.:.|||||||:.||:|.|.||||||||:..|||||:||
plant    78 QFVGTEVDPRTNS----FLTWDNLQSVLKNKVGLKGPMATPIGKGHRSLNLTLRKELNLYANVRP 138

  Fly   478 CRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMK 542
            |.||||.:|.|.|||::||||||||||||:||.:|.|||:|:|:|||.||:|||||.|.||....
plant   139 CYSLPGYKTRYDDVDLITIRENTEGEYSGLEHQVVKGVVESLKIITRKASMRVAEYAFLYAKTHG 203

  Fly   543 RKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLV 607
            ||||:|:.::.:|:.:|||||:|..|:||||..      |.||:..:...|:.:|::|..:|:||
plant   204 RKKVSAIHKANIMQKTDGLFLQCCDEVAAKYPE------IYYEKVVIDNCCMMLVKNPALFDVLV 262

  Fly   608 LPNLYGDIISDTCAGLIGGLGLTPSGNVGTNG-AIFESVHGTAPDIAGKDLANPTALLLSSVMML 671
            :||||||||||.||||:||||||||.|:|.:| |:.|:|||:||||||.:||||||||||.||||
plant   263 MPNLYGDIISDLCAGLVGGLGLTPSMNIGEDGIALAEAVHGSAPDIAGMNLANPTALLLSGVMML 327

  Fly   672 HYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIKNL 718
            .::.|::.|::|..|::.||.:...||.||||.:..:::|.|:..:|
plant   328 RHLKLNKQAEQIHSAIINTIAEGKYRTADLGGSSTTTDFTKAICDHL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 180/340 (53%)
IDH-VINP_850549.1 PLN00118 3..374 CDD:215062 186/370 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 426 1.000 Domainoid score I113
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D868374at2759
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 1 1.000 - - mtm1151
orthoMCL 1 0.900 - - OOG6_100541
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.