DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and Idh3a

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_083849.1 Gene:Idh3a / 67834 MGIID:1915084 Length:366 Species:Mus musculus


Alignment Length:356 Identity:208/356 - (58%)
Similarity:264/356 - (74%) Gaps:15/356 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 QGQKGGAGGKSGKASGEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMT 429
            |..:|.|||        .:.:||:||||||||||.:|:||.:|||.|:.:|..:||.:....|..
Mouse    22 QVTRGFAGG--------VQTVTLIPGDGIGPEISASVMKIFDAAKAPIQWEERNVTAIQGPGGKW 78

  Fly   430 SVPEQVIESMNRTKVGLKGPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIV 494
            .:|.:..|||::.|:||||||.||:..|..|:||.||:.|:||||:|||.|:.|.:|.|.||:||
Mouse    79 MIPPEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIV 143

  Fly   495 TIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSD 559
            |||||||||||||||.:|:||||||||||..||.|:||:.|:||....|..||||.::.:|||||
Mouse   144 TIRENTEGEYSGIEHVIVDGVVQSIKLITEEASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSD 208

  Fly   560 GLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLI 624
            ||||:..||:|...|.      ||:.|..:.|||||:||||.::|:||:|||||||:||.|||||
Mouse   209 GLFLQKCREVAENCKD------IKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLI 267

  Fly   625 GGLGLTPSGNVGTNG-AIFESVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVL 688
            ||||:|||||:|.|| |||||||||||||||||:|||||||||:||||.::||.:||.|||.|..
Mouse   268 GGLGVTPSGNIGANGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAAKIEAACF 332

  Fly   689 KTIRDDNIRTMDLGGKAKCSEYTDALIKNLK 719
            .||:|....|.||||.||||::|:.:.:.:|
Mouse   333 ATIKDGKSLTKDLGGNAKCSDFTEEICRRVK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 202/336 (60%)
Idh3aNP_083849.1 mito_nad_idh 29..362 CDD:272942 204/346 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S361
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100541
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.660

Return to query results.
Submit another query.