DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and idh3g

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001230101.1 Gene:idh3g / 550579 ZFINID:ZDB-GENE-050417-435 Length:391 Species:Danio rerio


Alignment Length:381 Identity:147/381 - (38%)
Similarity:231/381 - (60%) Gaps:26/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 ASKPPVKSPAGGQGQKGGAG--GKSGKASGEPRVI------------TLMPGDGIGPEISMAVIK 403
            |.||.:....|...:..|||  .:.||.:...|:|            ||:||||||||:...|.:
Zfish     8 ALKPILGRQLGNTAKVFGAGVVSQRGKPTYSGRIIPPPAKYGGRHTVTLIPGDGIGPELLNHVRE 72

  Fly   404 ILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGPLMT--PVGTGFRSLNLTLR 466
            :...:..|:.||.|.|.....|:...|   ..|.::.|..|.|||.:.|  .:....:|.|..||
Zfish    73 LFRFSCVPVDFEVVHVNSSSTSEDDIS---NAIMAIRRNGVALKGNIETNHTMPPNHKSRNNLLR 134

  Fly   467 QLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLVNGVVQSIKLITRNASLRVA 531
            ...:||||:..|:|||||:|.:.::||:.||||||||||.:||...:|||:.:|:||||.|||:|
Zfish   135 TSLDLYANVMHCQSLPGVQTRHKNIDIIIIRENTEGEYSSLEHESASGVVECLKIITRNNSLRIA 199

  Fly   532 EYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQAGIKYEESTMTTVCLNI 596
            :|.|:.|....|::||||.::.:|::.|||||:|.:|:|:.|..      |::|...:....:.:
Zfish   200 DYAFKLAREKGRRRVTAVHKANIMKLGDGLFLQCCKEVASGYPD------IEFENMIVDNTTMQL 258

  Fly   597 VQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIFE-SVHGTAPDIAGKDLANP 660
            |..|.::|::|:|||||:::|:.||||:||.||.|..|.|.:.|:|| :...|...||.:::|||
Zfish   259 VSKPYQFDVMVMPNLYGNVVSNVCAGLVGGPGLVPGANYGRDYAVFETATRNTGKSIANRNIANP 323

  Fly   661 TALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSEYTDALIK 716
            ||:||:|.:||.::.||::|:.|..|:|.|:.:..:.|:|:||:...||...::::
Zfish   324 TAMLLASCLMLDHLKLHDYANMIRSAILTTMNETRLHTVDIGGQGTTSEVVQSIMR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004 3/7 (43%)
Iso_dh 382..718 CDD:294303 138/350 (39%)
idh3gNP_001230101.1 mito_nad_idh 49..381 CDD:272942 136/340 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.