DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and CG3483

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_611912.1 Gene:CG3483 / 37900 FlyBaseID:FBgn0035005 Length:391 Species:Drosophila melanogaster


Alignment Length:397 Identity:137/397 - (34%)
Similarity:223/397 - (56%) Gaps:20/397 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PPTGSTPPQKPTKSSKPPNKPPAGPGKKSASKPPTASKPPVKSPAGGQGQKGGAGGKSGKASGEP 382
            ||..|........:.|...|..||...:...|||..     |..:.|...|..:.|.:..|....
  Fly    11 PPFRSVGGAYRLFAGKDQKKDSAGQKTRQPEKPPQD-----KQKSKGASGKAKSAGSTDSAKKTT 70

  Fly   383 RVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLK 447
            :| ||:.|:|:|.|:..||.:::.|.|.|:.:   ||.....::....|..:|::|:...|||:|
  Fly    71 KV-TLINGEGVGRELMDAVQEVICAVKAPIEW---DVHDEFKAKDSDDVSPEVLKSLRANKVGIK 131

  Fly   448 GPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLV 512
            ||:.:      |.....:|:.|..:|.:..|..:.|:::.|||.|:|.||:..||:||||||.:|
  Fly   132 GPVDS------RHWQRQIRKQFAQFAYVSLCSHIEGLDSPYGDFDVVIIRDQMEGDYSGIEHLVV 190

  Fly   513 NGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKM 577
            .||:|:||:.|...:.|:||:.|.||:..|||::|...::.:|||:||.||..:|..|.|:   :
  Fly   191 PGVMQTIKVSTTAGAARIAEFVFNYAVKNKRKRITVAHKANIMRMTDGNFLEAMRAEADKH---V 252

  Fly   578 DQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIF 642
            |.  :.:||..:.|..|.|:..|.:.|::|..::|||::.....|::|..|:.|..:|.:.|.:|
  Fly   253 DD--VLFEERYLDTCILKILLKPHKCDVMVSSSMYGDVLRVIAGGMMGVPGICPGYSVSSLGTVF 315

  Fly   643 ESVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKC 707
            :........:|||||||||..|||:.:||.::.:.:.||:::.|:.|..:|.:|||.|:||||||
  Fly   316 DCRMKACHALAGKDLANPTGPLLSAALMLRHVKMDKQADQVDCAIRKVYKDTDIRTPDVGGKAKC 380

  Fly   708 SEYTDAL 714
            ||:..|:
  Fly   381 SEFVKAV 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004 11/42 (26%)
Iso_dh 382..718 CDD:294303 122/333 (37%)
CG3483NP_611912.1 Iso_dh 71..389 CDD:294303 122/332 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469777
Domainoid 1 1.000 180 1.000 Domainoid score I145
eggNOG 1 0.900 - - E1_COG0473
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I184
Isobase 1 0.950 - 0 Normalized mean entropy S361
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 1 1.000 - - otm51400
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11835
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
1110.850

Return to query results.
Submit another query.