DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and IDH3G

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_004126.1 Gene:IDH3G / 3421 HGNCID:5386 Length:393 Species:Homo sapiens


Alignment Length:348 Identity:146/348 - (41%)
Similarity:220/348 - (63%) Gaps:14/348 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SGKASGEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESM 439
            |.|..|. ..:|::||||||||:.:.|..:...|..|:.||.|.|:...:.:.:    ...|.::
Human    48 SAKYGGR-HTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDI----RNAIMAI 107

  Fly   440 NRTKVGLKGPLMT--PVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEG 502
            .|.:|.|||.:.|  .:....:|.|..||...:||||:..|:|||||.|.:.|:||:.:||||||
Human   108 RRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEG 172

  Fly   503 EYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVR 567
            |||.:||..|.|||:|:|:||:..|||:|||.|:.|....|||||||.::.:|::.|||||:|.|
Human   173 EYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCR 237

  Fly   568 EMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPS 632
            |:||:|..      |.:|...:....:.:|..|:::|::|:|||||:|:::.||||:||.||...
Human   238 EVAARYPQ------ITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAG 296

  Fly   633 GNVGTNGAIFE-SVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNI 696
            .|.|...|:|| :...|...||.|::|||||.||:|.|||.::.||.:|..|.||||.::.::|:
Human   297 ANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENM 361

  Fly   697 RTMDLGGKAKCSEYTDALIKNLK 719
            .|.|:||:...||....:|::::
Human   362 HTPDIGGQGTTSEAIQDVIRHIR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 143/338 (42%)
IDH3GNP_004126.1 mito_nad_idh 52..383 CDD:272942 144/341 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.