DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and idh1

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_594397.1 Gene:idh1 / 2541894 PomBaseID:SPAC11G7.03 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:351 Identity:136/351 - (38%)
Similarity:210/351 - (59%) Gaps:17/351 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 GGKSGKASGEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPV-LNSQGMTSVPEQV 435
            |||        ..:||:||||||.|.|.||.:|.:.|..|:.||.:|||.: .|::.......:.
pombe    18 GGK--------YTVTLIPGDGIGRETSNAVTEIFKTANVPIEFEEIDVTGMEKNNKSSGDALHEA 74

  Fly   436 IESMNRTKVGLKGPLMTPVGT-GFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIREN 499
            |:|:.|.||||||.|.||... |..|.|:.||:..::||::...:::||.:|.:.:||...||||
pombe    75 IQSLKRNKVGLKGILFTPFEKGGHTSFNVALRKELDIYASLVLIKNIPGFKTRHDNVDFAIIREN 139

  Fly   500 TEGEYSGIEHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLR 564
            |||||||:||..|.|||:|:|:||...|.|:|::.|.:||...||.||.:.::.:|:::||||.|
pombe   140 TEGEYSGLEHQSVPGVVESLKIITEYKSKRIAQFAFDFALQNGRKSVTCIHKANIMKLADGLFRR 204

  Fly   565 CVREMAAKYKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGL 629
            ...::|..|.:      |..::..:....:..|..|:::|:||:|||||.|:|:..:.|:||.|:
pombe   205 TFYDVANGYDA------ITPKDLIVDNASMQAVSRPQQFDVLVMPNLYGSILSNIGSALVGGPGV 263

  Fly   630 TPSGNVGTNGAIFE-SVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRD 693
            .|..|.|.:.|:|| ........|.|:..|||||.:||:.:||.::||.::||.|..|....|.:
pombe   264 IPGANFGRDYALFEPGCRHVGLSITGRGEANPTAAILSACLMLRHLGLKDYADLINAATYSVIEE 328

  Fly   694 DNIRTMDLGGKAKCSEYTDALIKNLK 719
            ....|.||||.|...::|.|:::.::
pombe   329 GKTLTKDLGGSASTGDFTHAILERME 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 133/338 (39%)
idh1NP_594397.1 mito_nad_idh 18..353 CDD:272942 136/348 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.