DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and idh-2

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001370015.1 Gene:idh-2 / 181311 WormBaseID:WBGene00007942 Length:435 Species:Caenorhabditis elegans


Alignment Length:351 Identity:74/351 - (21%)
Similarity:128/351 - (36%) Gaps:81/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 NSQGMTSVPEQVIESMNRTKVGLKGPLMTPVGTGFRSLNL---------TLRQLFNLYANIRP-- 477
            |.|........::|.    .||:|...:||.....:..||         |:|.:........|  
 Worm    76 NDQVTIDAAHAILEH----SVGIKCATITPDEARIKEFNLKKMWLSPNGTIRNILGGTVFREPIL 136

  Fly   478 CRSLPGVETVYGDVDIVTIRENTEG-EYSGIEHTLVNGV--------------VQSIKLITRNAS 527
            |:::|  ..|.|....:||..:..| :|...:..:.:|.              |.::....::..
 Worm   137 CKNIP--RLVPGWTQPITIGRHAFGDQYKCTDLVIPSGSTLQLLVNKPDGSKDVHNVYDFKKSGG 199

  Fly   528 LRVAEYT------------FQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREM-AAKYKSKMDQ 579
            :.:|.|.            ||||| ||:..:....::.:::..||.|....::: ..||::....
 Worm   200 VGLAMYNTDESIKGFAHSCFQYAL-MKQWPLYLSTKNTILKKYDGRFKDIFQDIYEKKYEADFKN 263

  Fly   580 AGIKYEESTMTTVCLNIVQDP-------KRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGT 637
            ..|.||...:.......::..       |.||        ||:.||..|...|.|||..|..:..
 Worm   264 NKIWYEHRLIDDQVAQALKSSGGFVWACKNYD--------GDVQSDIVAQGYGSLGLMSSVLMCP 320

  Fly   638 NGAIF--ESVHGTAP------DIAGKDLANPTALLLSSVMMLHYIGLHEHAD-------KIEKAV 687
            :|...  |:.|||..      ........||.|.:.:....||:.|:.::.:       .:|||.
 Worm   321 DGKTIEAEAAHGTVTRHYREHQKGNSTSTNPIASIFAWTRGLHHRGVLDNNEALKTFSLTLEKAC 385

  Fly   688 LKTIRDDNIRTMDLG----GKAKCSE 709
            :.|:.:..: |.||.    |..|.:|
 Worm   386 IDTVEEGKM-TKDLSICIHGTKKGTE 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 74/351 (21%)
idh-2NP_001370015.1 PTZ00435 25..434 CDD:240417 74/351 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.