DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and AgaP_AGAP002728

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_003436225.1 Gene:AgaP_AGAP002728 / 1273240 VectorBaseID:AGAP002728 Length:417 Species:Anopheles gambiae


Alignment Length:400 Identity:240/400 - (60%)
Similarity:294/400 - (73%) Gaps:19/400 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 TGSTPPQKPTKSSKPPNKPPAGPGKKSASKPPTASKPPVKSPAGGQGQKGGAGGKSGKASGEPRV 384
            :.|:.....:.||...|...:    |:|:.....::|.|::.|        ..|....||| .|.
Mosquito    37 SSSSSSSNSSSSSSSTNSTVS----KAAATNAKRAEPIVQTVA--------PFGARTFASG-TRK 88

  Fly   385 ITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGP 449
            :||:||||||||||.||.||...|..|:.:|.||||||.|..|...:|:..|:|:||.|||||||
Mosquito    89 VTLIPGDGIGPEISAAVQKIFAVANVPIEWETVDVTPVRNPDGKFGIPQGAIDSVNRNKVGLKGP 153

  Fly   450 LMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLVNG 514
            ||||||.|.|||||.||:.||||||:||||||.|.:|:|.:||:||||||||||||||||.:|:|
Mosquito   154 LMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDNVDVVTIRENTEGEYSGIEHEIVDG 218

  Fly   515 VVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKMDQ 579
            |||||||||..||.|||||.|:||....|||||.|.::.:|||||||||||.|:||.||..    
Mosquito   219 VVQSIKLITEEASNRVAEYAFKYAKDNNRKKVTVVHKANIMRMSDGLFLRCCRDMAQKYPE---- 279

  Fly   580 AGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNGAIFES 644
              ||:||..:.|||||:||||::||:||:|||||||:||.||||:||||||||||:|.|||:|||
Mosquito   280 --IKFEERYLDTVCLNMVQDPRKYDVLVMPNLYGDILSDMCAGLVGGLGLTPSGNMGLNGALFES 342

  Fly   645 VHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAKCSE 709
            ||||||||||||||||||||||:||||.::.|::|||||:.|..:||::....|.||||||||||
Mosquito   343 VHGTAPDIAGKDLANPTALLLSAVMMLRHMELNQHADKIQSACFETIKEAKYLTGDLGGKAKCSE 407

  Fly   710 YTDALIKNLK 719
            ||:|:...:|
Mosquito   408 YTNAICDRIK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004 8/40 (20%)
Iso_dh 382..718 CDD:294303 226/335 (67%)
AgaP_AGAP002728XP_003436225.1 Iso_dh 85..416 CDD:294303 227/337 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X402
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.