DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32026 and Idh3a

DIOPT Version :9

Sequence 1:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_038936589.1 Gene:Idh3a / 114096 RGDID:70889 Length:374 Species:Rattus norvegicus


Alignment Length:338 Identity:202/338 - (59%)
Similarity:258/338 - (76%) Gaps:7/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 RVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLK 447
            :.:||:||||||||||.:|:||.:|||.|:.:|..:||.:....|...:|.:..|||::.|:|||
  Rat    40 QTVTLIPGDGIGPEISASVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPPEAKESMDKNKMGLK 104

  Fly   448 GPLMTPVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLV 512
            |||.||:..|..|:||.||:.|:||||:|||.|:.|.:|.|.||:|||||||||||||||||.:|
  Rat   105 GPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIV 169

  Fly   513 NGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYKSKM 577
            :||||||||||..||.|:||:.|:||....|..||||.::.:|||||||||:..||:|...|.  
  Rat   170 DGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAENCKD-- 232

  Fly   578 DQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNG-AI 641
                ||:.|..:.|||||:||||.::|:||:|||||||:||.|||||||||:|||||:|.|| ||
  Rat   233 ----IKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAI 293

  Fly   642 FESVHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGGKAK 706
            |||||||||||||||:|||||||||:||||.::||.:||.|||.|...||:|....|.||||.:|
  Rat   294 FESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAAKIEAACFATIKDGKSLTKDLGGNSK 358

  Fly   707 CSEYTDALIKNLK 719
            ||::|:.:.:.:|
  Rat   359 CSDFTEEICRRVK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 201/335 (60%)
Idh3aXP_038936589.1 mito_nad_idh 38..370 CDD:272942 201/335 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100541
Panther 1 1.100 - - O PTHR11835
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X402
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.