DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LIMS3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001381830.1 Gene:LIMS3 / 96626 HGNCID:30047 Length:398 Species:Homo sapiens


Alignment Length:318 Identity:73/318 - (22%)
Similarity:122/318 - (38%) Gaps:81/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 RPCVA---DTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLY-IHGNART-----TFYDV 357
            |||:.   :.:||.:.            |..||.|.:....|...|. .|.:.:.     .||  
Human     8 RPCIIPENEEIPRAAL------------NTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFY-- 58

  Fly   358 NSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQIN 422
                  .|..:.|.::..|           |.:|........:...:..::||..||.|..|...
Human    59 ------AKFNMANALASAT-----------CERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQ 106

  Fly   423 LQGKPFYALDGKPYCEYDYLQTLEK-CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLF 486
            .....||..:|:.|||:|:...... |..|.|.|:.|:::|....:||:||.|.:|.:.|..:.|
Human   107 FPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGF 171

  Fly   487 TVDATNQNYCITDFHKKFAPR------CCVC-----KQPIM--PDPGQEETIRVVALDRSFHLEC 538
            ..:| .::.| ...|.:...|      |..|     :||::  .||              :|.:.
Human   172 VKNA-GRHLC-RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDP--------------YHPDH 220

  Fly   539 YKCEDCGLLLSSEA-EGRG---CYPLDDHV---LCKSC----NAKRVQALTNRMTSEH 585
            :.|.:||..|:::| |.:|   |.|..|.:   :|.:|    ..:.|.|:..:...||
Human   221 FNCANCGKDLTADAQELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 17/58 (29%)
LIM3_LPP 508..575 CDD:188821 19/84 (23%)
LIMS3NP_001381830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.