DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and FHL5

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:226 Identity:63/226 - (27%)
Similarity:94/226 - (41%) Gaps:26/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 KNYISIPTEPV------QELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKP 427
            |.|:.....|.      :...||  |.:|...:..:|......|:.:|..||.||.|..:|..||
Human    18 KKYVLKDDSPYCVTCYDRVFSNY--CEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKP 80

  Fly   428 FYALDGKPYCEYDYL-QTLEKCSVCMEPIL--ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVD 489
            |.|.|.:..|...|. :...||..|...|:  .|.:...|..:|..||.|..|.:.: |....:.
Human    81 FAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPI-GTKPLIS 144

  Fly   490 ATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGL-LLSSEAE 553
            ..:.|||:..|.|:||..|..||: ::...|      :...|:.:|.||:.|..|.. |...:..
Human   145 KESGNYCVPCFEKEFAHYCNFCKK-VITSGG------ITFCDQLWHKECFLCSGCRKDLCEEQFM 202

  Fly   554 GRGCYP--LD--DHVLCKSCNA--KRVQALT 578
            .|..||  :|  :|:....|.|  |.:..||
Human   203 SRDDYPFCVDCYNHLYANKCVACSKPISGLT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/52 (33%)
LIM2_LPP 448..507 CDD:188740 18/60 (30%)
LIM3_LPP 508..575 CDD:188821 19/73 (26%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770 3/15 (20%)
LIM1_FHL 37..95 CDD:188729 19/59 (32%)
LIM2_FHL5 102..155 CDD:188812 14/53 (26%)
LIM3_FHL 163..214 CDD:188732 15/57 (26%)
LIM4_FHL 222..277 CDD:188733 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.