DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and PDLIM1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:325 Identity:64/325 - (19%)
Similarity:116/325 - (35%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 QPLN-SFTKPLSKTLSKSLIYSNLGSVRKEIE-----TLELLTDETKISASTYSNVNETAMDSSH 209
            |||. |...|.||....:|.   :|.|...|:     .:..|..:.:|...| .|:..|...|.|
Human    26 QPLAISRVTPGSKAALANLC---IGDVITAIDGENTSNMTHLEAQNRIKGCT-DNLTLTVARSEH 86

  Fly   210 ---------------------SSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSELRHATL 253
                                 |..|::|.:.    |.:.:..:|...||.|:.::.         
Human    87 KVWSPLVTEEGKRHPYKMNLASEPQEVLHIG----SAHNRSAMPFTASPASSTTAR--------- 138

  Fly   254 EFNKPIDYLQNNQTTNPLQIYANQYAMQHDATGKSSSTYDSIYEPINPRPCVADTLPRESYNLHN 318
                    :..||..||..:|:::.....:...:|.:....:         .|::.|.:.....:
Human   139 --------VITNQYNNPAGLYSSENISNFNNALESKTAASGV---------EANSRPLDHAQPPS 186

  Fly   319 SYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKN----YISIPTEPV 379
            |.|      |..|..:...::..|.|.......|:|..:..|..::::|..|    :.|:.....
Human   187 SLV------IDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVT 245

  Fly   380 QELENYGR------CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCE 438
            :...:.|.      |.||.:.::|..  ....|:..|..|:.||||..||:.|..:.::.:.|||
Human   246 KVAASIGNAQKLPMCDKCGTGIVGVF--VKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCE 308

  Fly   439  438
            Human   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/51 (33%)
LIM2_LPP 448..507 CDD:188740
LIM3_LPP 508..575 CDD:188821
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492 16/59 (27%)
DUF4749 138..230 CDD:318205 17/123 (14%)
LIM_CLP36 260..311 CDD:188832 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.