DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and RGA1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_014770.1 Gene:RGA1 / 854294 SGDID:S000005653 Length:1007 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:38/165 - (23%)
Similarity:56/165 - (33%) Gaps:52/165 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 ENYGRCVKCNSRVL---GESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQT 444
            |.:..||:|...:.   ....||..    :|..||.|..|:     ||.       .||.|:|..
Yeast     8 EQFPSCVRCKEFITTGHAYELGCDR----WHTHCFACYKCE-----KPL-------SCESDFLVL 56

  Fly   445 LEKCSVCMEPILERILRATGKPYHPQCF-TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRC 508
            .....:|.:                 |. :|..|||.:|.|...:.::|:.||...|      :|
Yeast    57 GTGALICFD-----------------CSDSCKNCGKKIDDLAIILSSSNEAYCSDCF------KC 98

  Fly   509 CVCKQPIMPDPGQEETIRVVALDRSFHLECYKCED 543
            |.|.:.|       ..:|.....|.  |.|..|.:
Yeast    99 CKCGENI-------ADLRYAKTKRG--LFCLSCHE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/55 (25%)
LIM2_LPP 448..507 CDD:188740 12/59 (20%)
LIM3_LPP 508..575 CDD:188821 9/36 (25%)
RGA1NP_014770.1 LIM1_Rga 13..67 CDD:188780 17/86 (20%)
LIM2_Rga 70..123 CDD:188781 18/67 (27%)
Smc <569..>673 CDD:224117
RhoGAP 803..1002 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.