DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and RGA2

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_010667.1 Gene:RGA2 / 851985 SGDID:S000002787 Length:1009 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:39/138 - (28%)
Similarity:57/138 - (41%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 EPVQELENYGRCVKCNSRVLGESSGCTAMDQIY-------HIFCFTCTDCQINLQG-KPFYALD- 432
            :|:.:..:.  ||:||..:        |..|:|       |..||||..|...|.. ..|..|| 
Yeast     4 DPINDQSSL--CVRCNKSI--------ASSQVYELESKKWHDQCFTCYKCDKKLNADSDFLVLDI 58

  Fly   433 GKPYCEYDYLQTLEKCSVCMEPILER--ILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNY 495
            |...| ||   ..:||:.|.:.|.:.  ||.::.:.|...||.|..|...:..|.:.  .|.:..
Yeast    59 GTLIC-YD---CSDKCTNCGDKIDDTAIILPSSNEAYCSNCFRCCRCSNRIKNLKYA--KTKRGL 117

  Fly   496 CITDFHKK 503
            |..|.|:|
Yeast   118 CCMDCHEK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 20/61 (33%)
LIM2_LPP 448..507 CDD:188740 16/58 (28%)
LIM3_LPP 508..575 CDD:188821
RGA2NP_010667.1 LIM1_Rga 13..67 CDD:188780 21/65 (32%)
LIM2_Rga 70..123 CDD:188781 14/54 (26%)
RhoGAP 815..1002 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.