DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LRG1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:54/166 - (32%)
Similarity:72/166 - (43%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGES----SGCTAMDQIYHIFCFTCTDCQINLQGKPF-YALDGKP----YCEYDYLQ 443
            |.:||..|:.:|    :...|:.:.||..||||.|||..|:.|.| |.:|...    .|:|||.:
Yeast    28 CARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYFR 92

  Fly   444 TLE-KCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPR 507
            ... .|.||..|:......|.|..|..:.|:|.:|.... |:.......||.||...|.|.|:.|
Yeast    93 RHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTICATPC-GVKKCFMYGNQLYCKYHFLKYFSKR 156

  Fly   508 CCVCKQPIMPD----PGQEETIRVVALDRSFHLECY 539
            |..|:.||...    |..||.       ..:|.|||
Yeast   157 CKGCEFPISDQYIEFPKGEEI-------HCWHPECY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 22/61 (36%)
LIM2_LPP 448..507 CDD:188740 18/58 (31%)
LIM3_LPP 508..575 CDD:188821 11/36 (31%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 22/61 (36%)
LIM 98..149 CDD:259829 15/51 (29%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.