Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_116265.1 | Gene: | AJUBA / 84962 | HGNCID: | 20250 | Length: | 538 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 103/205 - (50%) |
---|---|---|---|
Similarity: | 138/205 - (67%) | Gaps: | 6/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 EPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDY 441
Fly 442 L-----QTLEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFH 501
Fly 502 KKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLC 566
Fly 567 KSCNAKRVQA 576 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 23/52 (44%) |
LIM2_LPP | 448..507 | CDD:188740 | 36/58 (62%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 34/66 (52%) | ||
AJUBA | NP_116265.1 | PreLIM | 1..335 | 2/7 (29%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..172 | ||||
PHA03418 | <18..>103 | CDD:177646 | |||
Nuclear localization signal. /evidence=ECO:0000255 | 280..288 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 291..315 | ||||
LIM1_Ajuba_like | 338..391 | CDD:188738 | 23/52 (44%) | ||
LIM2_Ajuba_like | 403..455 | CDD:188741 | 32/51 (63%) | ||
LIM3_Ajuba_like | 463..524 | CDD:188822 | 32/61 (52%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |