DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and WLIM1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:170 Identity:38/170 - (22%)
Similarity:65/170 - (38%) Gaps:40/170 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 RCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVC 451
            :|:.|:..|..... .||.:::||..||.|..|:..|:...:.:.:|..||...:.|..::..  
plant     9 KCMACDKTVYLVDK-LTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTG-- 70

  Fly   452 MEPILERILRAT---GKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFA---PRCCV 510
               .||:....|   |||..|           |:|         :....|.....|.   .:|..
plant    71 ---SLEKSFEGTPKIGKPDRP-----------LEG---------ERPAGTKVSNMFGGTREKCVG 112

  Fly   511 CKQPIMPDPGQEETIRVVALDRS-FHLECYKCEDCGLLLS 549
            |.:.:.|       |..|:::.: :|..|:||...|..:|
plant   113 CDKTVYP-------IEKVSVNGTLYHKSCFKCTHGGCTIS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 11/64 (17%)
LIM3_LPP 508..575 CDD:188821 11/43 (26%)
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 16/59 (27%)
LIM2_SF3 110..170 CDD:188825 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.