DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LHX3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_055379.1 Gene:LHX3 / 8022 HGNCID:6595 Length:402 Species:Homo sapiens


Alignment Length:131 Identity:40/131 - (30%)
Similarity:62/131 - (47%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 DYLQTLEKCSVCMEPILER-ILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKK 503
            |..:.:..|:.|.:.||:| ||:|..:.:|.:|..|..|...|....|:  .....||..||.|:
Human    28 DLRREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFS--RGESVYCKDDFFKR 90

  Fly   504 FAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDD-HVLCK 567
            |..:|..|:..|.|    .:.:| .|.|..:||.|:.|..|...|   |.|...|.::| .::||
Human    91 FGTKCAACQLGIPP----TQVVR-RAQDFVYHLHCFACVVCKRQL---ATGDEFYLMEDSRLVCK 147

  Fly   568 S 568
            :
Human   148 A 148

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity