DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Limch1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_036021493.1 Gene:Limch1 / 77569 MGIID:1924819 Length:1511 Species:Mus musculus


Alignment Length:330 Identity:69/330 - (20%)
Similarity:113/330 - (34%) Gaps:94/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELSLP--KGDTGSPLVCIGHGKVAKLVAKISNNQNA--SVKRRLDIPPKPPIKYNEMPQVPSSRQ 70
            ||..|  .|:..||      |..|.:.|.:..:::|  |.|||            ::.|  :..:
Mouse   345 ELEAPPSNGEDQSP------GDAAVVPAALPEDRDAVESQKRR------------KLEQ--AGIK 389

  Fly    71 VLCSREPLYSQPLIGVEKTMRGHMPFRK---YLSSEFGVADTQINRKTTLDNPAILEQQLEA--L 130
            |:.:.:...||.....||.....:..||   :|:.:.| .|::     :.|..|.|...||.  .
Mouse   390 VMPAAQRFASQKQSSEEKEAIRDIVLRKENPFLTHQHG-KDSE-----SEDEAACLLPDLEKDDF 448

  Fly   131 AYHKLQMEKKGLLGVQAKPTQPLNSF---------------TKPLSKTLS--KSLIYSNLGSVRK 178
            |..:.:|.       |:||..|||..               :|.|||.||  |:|.:......|:
Mouse   449 AARRAKMN-------QSKPMVPLNQLLYGPYRNKDAEKAGGSKQLSKGLSDKKNLGFKRNQGQRE 506

  Fly   179 EIETLELLTDETKISASTYSNVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPP-------PPS 236
            ::.|:...|.:|:......:|..:|                    .|..||:|..       .|.
Mouse   507 DVNTMVACTVQTQKDEPLETNFRKT--------------------PDRHKDDLAQRRIQGRLTPH 551

  Fly   237 PESAVSSSYSELRHATLEFNKPIDY--------LQNNQTTNPLQIYANQYAMQHDATGKSSSTYD 293
            .|:......|.:..|.||..:.:..        .||.....|......:.|::.|...:.:..|.
Mouse   552 REAPSFIKLSGITEADLETWERLKVSGETRDGDAQNTCAPEPSPEIDTETAIRDDFASRKARAYK 616

  Fly   294 SIYEP 298
            ....|
Mouse   617 KASGP 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737
LIM2_LPP 448..507 CDD:188740
LIM3_LPP 508..575 CDD:188821
Limch1XP_036021493.1 CH_LIMCH1 23..140 CDD:409127
DUF4757 250..>311 CDD:406382
DUF4757 <739..872 CDD:406382
GBP_C <1225..1262 CDD:419202
LIM 1441..1498 CDD:214528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.