DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and ZNF185

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_016885310.1 Gene:ZNF185 / 7739 HGNCID:12976 Length:766 Species:Homo sapiens


Alignment Length:160 Identity:40/160 - (25%)
Similarity:53/160 - (33%) Gaps:50/160 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PTEPVQE-----LENYGRCVKCNSRVLGESSGC------TAMDQIYHI----------------- 411
            |:.|.|:     .|.:.|...|.|||...|| |      ||..:..||                 
Human   588 PSTPEQQNSPSGSEQFVRRESCTSRVRSPSS-CMVTVTVTATSEQPHIYIPAPASELDSSSTTKG 651

  Fly   412 --FCFTCTDCQINLQGKPF-------------YALDGKPYC---EYDYLQTLEKCSVCMEPILE- 457
              |.....:......|||.             :|::.||.|   .|....|...|:.|...|.: 
Human   652 ILFVKEYVNASEVSSGKPVSARYSNVSSIEDSFAMEKKPPCGSTPYSERTTGGICTYCNREIRDC 716

  Fly   458 -RI-LRATGKPYHPQCFTCVVCGKSLDGLL 485
             :| |...|...|..||.|.:|.|.:..||
Human   717 PKITLEHLGICCHEYCFKCGICSKPMGDLL 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 20/93 (22%)
LIM2_LPP 448..507 CDD:188740 14/41 (34%)
LIM3_LPP 508..575 CDD:188821
ZNF185XP_016885310.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.