DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fblim1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001070771.1 Gene:fblim1 / 768160 ZFINID:ZDB-GENE-061013-662 Length:292 Species:Danio rerio


Alignment Length:184 Identity:66/184 - (35%)
Similarity:104/184 - (56%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEKCSVCM 452
            |..|..:|....|...|:::.||..||.|..|...|.|:.:|:..|.|.||..:..:||.|..|.
Zfish   105 CGFCRKQVSPCESAIVALNRCYHSGCFQCRQCCAPLAGRQYYSRSGLPLCEACHQASLEPCWACG 169

  Fly   453 EPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMP 517
            :.|.:.::||..:.|||.||.|..|.:.:....|......:.||:.|:::|:||:|.||...|:|
Zfish   170 DVIKDHVIRALERAYHPPCFVCTTCRQPIGEQRFAQGEVGEVYCLQDYYRKYAPQCGVCGLMIIP 234

  Fly   518 DPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNA 571
            .....::..|..|.||:|.:||:|:.|.:|||.|.:.|||:|||..:||::|::
Zfish   235 RDDGTDSFTVECLGRSYHEDCYRCQVCAVLLSPEPDERGCHPLDGQMLCRTCHS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 18/52 (35%)
LIM2_LPP 448..507 CDD:188740 18/58 (31%)
LIM3_LPP 508..575 CDD:188821 27/64 (42%)
fblim1NP_001070771.1 LIM <100..158 CDD:295319 18/52 (35%)
LIM 165..217 CDD:295319 15/51 (29%)
LIM 225..287 CDD:295319 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24207
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.