DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Pdlim7

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001107560.1 Gene:Pdlim7 / 67399 MGIID:1914649 Length:457 Species:Mus musculus


Alignment Length:425 Identity:97/425 - (22%)
Similarity:143/425 - (33%) Gaps:87/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 ETAMDSSHSSTQKMLSVCTNFIS----------DNEKDELPPPPSPESAVSSSYSELRHATLEFN 256
            |.|...:|...|..:..|...:|          ...:..|.||..|.....:..:.|......|.
Mouse    56 ENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKALTPPADPPRYTFAPSASLNKTARPFG 120

  Fly   257 KP----IDYLQNNQ-TTNPLQIYANQYAMQ-------HDATGKSSS------------------- 290
            .|    ....||.| ...|:...:.|..|:       ...||:|.|                   
Mouse   121 APPPTDSTLRQNGQLLRQPVPDASKQRLMEDTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEE 185

  Fly   291 -TYDSIYEPINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQT---LYIHGNAR 351
             ...|...|....|..|.|:|:||:....:....:.|..:.:...:.....::|   |..|....
Mouse   186 FMKKSSQVPRTEAPAPASTIPQESWPGPTTPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPA 250

  Fly   352 TTFYDVNSIHRNDKEGLKNYISIPTEPVQEL--------ENYGR---CVKCNSRVLGESSGCTAM 405
            |            ...|:|..||    ||..        .|.|:   |.:|:..:.|..  ..|:
Mouse   251 T------------PTPLQNRTSI----VQAAAGGGTGGGSNNGKTPVCHQCHKIIRGRY--LVAL 297

  Fly   406 DQIYHIFCFTCTDCQINLQGKPFYALDGKPYCE--YDYLQTLEKCSVCMEPILERILRATGKPYH 468
            ...||...|.|:.|...|:...|:...|..:|.  || ::....|:.|.:.|...|:.|....:|
Mouse   298 GHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYD-VRYAPNCAKCKKKITGEIMHALKMTWH 361

  Fly   469 PQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRS 533
            ..||||..|...:....|.:: ....||..|:.|.|..:|..|...|  |.|..   .:.||..|
Mouse   362 VHCFTCAACKTPIRNRAFYME-EGAPYCERDYEKMFGTKCRGCDFKI--DAGDR---FLEALGFS 420

  Fly   534 FHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKS 568
            :|..|:.|..|.:.|    ||:..|...|..||||
Mouse   421 WHDTCFVCAICQINL----EGKTFYSKKDKPLCKS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/54 (26%)
LIM2_LPP 448..507 CDD:188740 17/58 (29%)
LIM3_LPP 508..575 CDD:188821 21/61 (34%)
Pdlim7NP_001107560.1 PDZ_signaling 5..79 CDD:238492 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..166 16/83 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..226 9/40 (23%)
LIM1_Enigma 282..333 CDD:188836 13/52 (25%)
LIM2_Enigma 341..392 CDD:188840 14/51 (27%)
LIM3_Enigma 400..454 CDD:188842 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.