Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342427.1 | Gene: | Fhl5 / 57756 | MGIID: | 1913192 | Length: | 284 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 21/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 384 NYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-QTLEK 447
Fly 448 CSVCMEPIL--ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCV 510
Fly 511 CKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSC----NA 571
Fly 572 KRVQALTNRMT 582 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 15/52 (29%) |
LIM2_LPP | 448..507 | CDD:188740 | 18/60 (30%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 19/70 (27%) | ||
Fhl5 | NP_001342427.1 | LIM | <3..34 | CDD:413332 | |
LIM1_FHL | 37..95 | CDD:188729 | 17/57 (30%) | ||
LIM2_FHL5 | 102..155 | CDD:188812 | 14/53 (26%) | ||
LIM | 163..214 | CDD:413332 | 16/61 (26%) | ||
LIM4_FHL | 222..277 | CDD:188733 | 3/9 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |