DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and pxnb

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021334029.1 Gene:pxnb / 565130 ZFINID:ZDB-GENE-130530-697 Length:1197 Species:Danio rerio


Alignment Length:223 Identity:61/223 - (27%)
Similarity:97/223 - (43%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 GRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KCS 449
            |.|..|:..::|:.  .|||.:.:|...|.||.||..:..:.|:..:|:||||.||..... :|.
Zfish   962 GVCGACSKPIVGQV--VTAMGRTWHPEHFVCTHCQEEIGSRNFFEREGQPYCERDYHHLFSPRCY 1024

  Fly   450 VCMEPILERILRATGKPYHPQCFTCVVCG--------KSLDGLLFTVDATNQNYCITDFHKKFAP 506
            .|..|||::::.|..:.:||:.|.|..||        ...||         :.||..|:...|||
Zfish  1025 YCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDG---------KAYCRKDYFDLFAP 1080

  Fly   507 RCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDC------GLLLSSEAEGRGCYPLDDHV- 564
            :|..|.:.|:.:       .:.||...:|.||:.|.:|      |...  |.:|:....:..|. 
Zfish  1081 KCGGCARAILEN-------YISALSSLWHPECFVCRECFTPFVNGSFF--EHDGQPYCEVHYHAR 1136

  Fly   565 ---LCKSC----NAKRVQALTNRMTSEH 585
               ||..|    ..:.:.|:..:...||
Zfish  1137 RGSLCSGCQKPITGRCITAMGKKFHPEH 1164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 18/52 (35%)
LIM2_LPP 448..507 CDD:188740 19/66 (29%)
LIM3_LPP 508..575 CDD:188821 17/80 (21%)
pxnbXP_021334029.1 Paxillin 96..272 CDD:308898
Atrophin-1 <178..684 CDD:331285
LIM1_Paxillin_like 964..1016 CDD:259830 19/53 (36%)
LIM2_Paxillin_like 1023..1074 CDD:188723 16/59 (27%)
LIM3_Paxillin_like 1082..1134 CDD:188724 13/60 (22%)
LIM4_Paxillin 1141..1192 CDD:188795 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.