DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and limd1a

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021322480.1 Gene:limd1a / 562793 ZFINID:ZDB-GENE-070712-1 Length:187 Species:Danio rerio


Alignment Length:182 Identity:92/182 - (50%)
Similarity:124/182 - (68%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 MDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-----QTLEKCSVCMEPILERILRATG 464
            |..:||..||||:.|...|:||.||.:.||.:||.|:|     |:.:|||||...|::.||:|.|
Zfish     1 MGSLYHDSCFTCSACSRKLRGKAFYFVCGKVFCEEDFLYSGFQQSADKCSVCGHLIMDMILQALG 65

  Fly   465 KPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVA 529
            |.|||.||.|.:|.:||||:.||||..|:.||:.|:|:..||:|..|.|||:|..|.:||||||:
Zfish    66 KSYHPGCFRCAICNESLDGVPFTVDTENKIYCVKDYHRVLAPKCAACNQPILPSEGSDETIRVVS 130

  Fly   530 LDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRV--QALTN 579
            :||.:|:|||.||||.:.|:.| ||..|||||.|:||.:|:.|.:  |:..|
Zfish   131 MDRDYHVECYHCEDCQMELNDE-EGHRCYPLDGHLLCHACHLKHIDPQSTAN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/35 (49%)
LIM2_LPP 448..507 CDD:188740 31/58 (53%)
LIM3_LPP 508..575 CDD:188821 37/68 (54%)
limd1aXP_021322480.1 LIM <1..37 CDD:295319 17/35 (49%)
LIM2_Ajuba_like 49..101 CDD:188741 28/51 (55%)
LIM3_Ajuba_like 109..170 CDD:188822 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.