DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LIMS2

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:220 Identity:58/220 - (26%)
Similarity:91/220 - (41%) Gaps:35/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK-CSVC 451
            |.:|.:|.........:..::||..||.|..|........||..:|:.|||:|:...... |..|
Human    39 CQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCEHDFQMLFAPCCGSC 103

  Fly   452 MEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYC--------ITDFHKKFAPRC 508
            .|.|:.|:::|....:||.||.|.:|...|..|.|..:| .::.|        .....|....||
Human   104 GEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNA-GRHLCRPCHNREKAKGLGKYICQRC 167

  Fly   509 --CVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEA-EGRG---CYPLDDHV--- 564
              .:.:||:|            ....::|.:.:.|..||..|::|| |.:|   |.|..|.:   
Human   168 HLVIDEQPLM------------FRSDAYHPDHFNCTHCGKELTAEARELKGELYCLPCHDKMGVP 220

  Fly   565 LCKSC----NAKRVQALTNRMTSEH 585
            :|.:|    ..:.|.||..:...||
Human   221 ICGACRRPIEGRVVNALGKQWHVEH 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 18/66 (27%)
LIM3_LPP 508..575 CDD:188821 18/79 (23%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717 16/57 (28%)
LIM2_PINCH 100..151 CDD:188718 17/51 (33%)
LIM3_PINCH 164..214 CDD:188719 16/61 (26%)
LIM4_PINCH 220..273 CDD:188720 7/26 (27%)
LIM5_PINCH 281..334 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.