DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and prickle1b

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001025269.1 Gene:prickle1b / 556148 ZFINID:ZDB-GENE-030131-2152 Length:872 Species:Danio rerio


Alignment Length:302 Identity:72/302 - (23%)
Similarity:106/302 - (35%) Gaps:74/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 LPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYIS 373
            ||.|..    .||  |:|...|        ...|.||             .:..:|.| ::...|
Zfish    73 LPEEKV----PYV--NSPGEKH--------RIRQLLY-------------QLPPHDNE-IRYCQS 109

  Fly   374 IPTEPVQEL---------ENYGR-------------CVKCNSRVLGESSGCTAM----DQIYHIF 412
            :..|..:||         |..||             |..|...:.|......|.    ...:|..
Zfish   110 LSDEERRELHMFSMQRKKEALGRGTPKLLPRALQHNCEHCKENINGGEMAVFASRAGPGPCWHPA 174

  Fly   413 CFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KCSVCMEPIL-ERILRATGKPYHPQCFTCV 475
            ||||..|...|....::..:|..:|...:.:.|: :||.|.|.|. :....|.|:.:|.:.|:|.
Zfish   175 CFTCYTCHELLVDLIYFYHNGNIHCGRHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFSCF 239

  Fly   476 VCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQ--EETIRVVALDRSFHLEC 538
            .|...|.|..: :....:.:|...|...:|..|..|.:.|..|..|  .|.:...|.|:     |
Zfish   240 ECETILGGQRY-IMKDGRPFCCGCFESLYAEYCEACGENIGVDHAQMTYEGVHWHATDK-----C 298

  Fly   539 YKCEDCGLLLSSEAEGRGC--YPLDDHVLC-KSCN-AKRVQA 576
            :.|..|...|      .||  .|.|..:.| |.|: .:.|||
Zfish   299 FCCAQCKTSL------LGCPFLPKDGRIYCSKDCSLGEDVQA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 13/56 (23%)
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 19/72 (26%)
prickle1bNP_001025269.1 PET_Prickle 43..139 CDD:193602 20/93 (22%)
LIM1_Prickle 146..204 CDD:188799 13/57 (23%)
LIM2_Prickle 209..264 CDD:188802 14/55 (25%)
LIM3_Prickle 269..327 CDD:188804 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.