DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fhl3b

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:317 Identity:77/317 - (24%)
Similarity:124/317 - (39%) Gaps:47/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 DATGKSSSTYDSIYEPINPRP-CVA--DTLPRESYNLHNSYVNDNNPNISHE---YN-------- 333
            |......|.|...|..::.:| ||.  |.|...:.:.....:..|:..:.||   |:        
Zfish     6 DCESCKESLYGQKYIQVDDKPHCVPCYDRLHANTCHECKELIEHNSRELYHEDRHYHEQCFRCSR 70

  Fly   334 ISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGE 398
            .|.|: |.::.....:|..    .|:.:.|                   |....||.|...|:..
Zfish    71 CSRSL-AKESFTCQEDALV----CNNCYCN-------------------EFSSNCVACGKTVMPG 111

  Fly   399 SSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-QTLEKCSVCMEPILERILRA 462
            |......|.::|..||.|..|:..:..:.|.....:.||...|. :...:|:.|.:.:::..:..
Zfish   112 SKRLEYEDCVWHEECFVCCGCEQPIGAQSFIPDKDEYYCVPCYEGRFAPRCAHCKQTLVQGGVTY 176

  Fly   463 TGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRV 527
            ..:|:|.:||.|..|...|.|..||....:. ||:..|...:|.:|..|::||   .|..|...|
Zfish   177 RDEPWHKECFLCTGCKVQLAGQPFTTQGEDP-YCVKCFSNLYAQKCAACEKPI---TGFGEGKYV 237

  Fly   528 VALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRVQALTNRMTSE 584
            ...:|.:|..|:||..|.|.|    .|.|.:|....:|||.||.|::..:....|.|
Zfish   238 SFEERQWHKPCFKCSVCSLSL----VGAGFFPHGSMILCKGCNTKKLFQIVCEQTIE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 16/58 (28%)
LIM3_LPP 508..575 CDD:188821 24/66 (36%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319 7/26 (27%)
LIM1_FHL3 36..94 CDD:188807 9/62 (15%)
LIM2_FHL3 98..155 CDD:188811 14/56 (25%)
LIM3_FHL 162..213 CDD:188732 14/51 (27%)
LIM4_FHL3 221..276 CDD:188818 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.