DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and lhx8

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_012816489.1 Gene:lhx8 / 548653 XenbaseID:XB-GENE-494997 Length:385 Species:Xenopus tropicalis


Alignment Length:142 Identity:35/142 - (24%)
Similarity:58/142 - (40%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SIPTEPVQELE---------NYGR--CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINL-QG 425
            |:|..||....         |.|:  |..|...:: :.......|..:|:.|.:|:.|:.:| :.
 Frog    78 SVPLSPVSSSSPHSMPAAGLNQGKSVCSNCGLEIV-DKYLLKVNDLCWHVRCLSCSVCRTSLGRH 141

  Fly   426 KPFYALDGKPYCEYDYLQTL-EKCSVCMEPI--LERILRATGKPYHPQCFTCVVCGKSLDGLLFT 487
            ...|..|...||:.||.:.. .:||.|...|  .:.:.||.|..||..||.|..|.:.|      
 Frog   142 TSCYIKDKDIYCKLDYFRRYGTRCSRCGRHIHATDWVRRAKGNVYHLACFACYSCKRQL------ 200

  Fly   488 VDATNQNYCITD 499
              :|.:.:.:.:
 Frog   201 --STGEEFALVE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 12/53 (23%)
LIM2_LPP 448..507 CDD:188740 15/54 (28%)
LIM3_LPP 508..575 CDD:188821
lhx8XP_012816489.1 LIM1_Lhx7_Lhx8 103..158 CDD:188767 13/55 (24%)
LIM2_Lhx7_Lhx8 165..219 CDD:188769 15/54 (28%)
Homeobox 258..311 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.