powered by:
Protein Alignment Zyx and Magix
DIOPT Version :9
Sequence 1: | NP_652015.1 |
Gene: | Zyx / 317824 |
FlyBaseID: | FBgn0011642 |
Length: | 585 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_061302.2 |
Gene: | Magix / 54634 |
MGIID: | 1859644 |
Length: | 324 |
Species: | Mus musculus |
Alignment Length: | 51 |
Identity: | 19/51 - (37%) |
Similarity: | 28/51 - (54%) |
Gaps: | 9/51 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 246 SELRHATLEFNKPIDYLQNNQT----TNPLQIYANQ--YAMQ-HDATGKSS 289
|.|.||||..::| ..|.::| |.||.:..|: ||:: ..|||:.|
Mouse 80 SRLPHATLVKHRP--QHQRSETLGTWTEPLPVTQNKASYALKVPQATGRFS 128
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.