DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Pdlim3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001361581.1 Gene:Pdlim3 / 53318 MGIID:1859274 Length:364 Species:Mus musculus


Alignment Length:264 Identity:58/264 - (21%)
Similarity:98/264 - (37%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 STYSNVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPI 259
            ||.|.|:..:..|:.||...:.::|...:....|  :.|                :..||...|.
Mouse   136 STPSGVDCGSGRSTPSSVSTVSTICPGDLKVAAK--MAP----------------NIPLEMELPG 182

  Fly   260 DYLQNNQTTNPLQIYANQYAMQ------HDATGKSSSTYDSIYEPINPRPCVAD----------- 307
            ..:.:.|...|:|:|::...|:      ..|.|::|    |:.||....|..:|           
Mouse   183 VKIVHAQFNTPMQLYSDDNIMETLQGQVATALGETS----SMSEPTASVPPQSDVYRMLHDNRDD 243

  Fly   308 -TLPRE--SYNLHNSYVNDNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLK 369
             ..||:  |:.:....|||...:....   :.|:.|..| .:||.|.:.                
Mouse   244 PAAPRQSGSFRVLQDLVNDGPDDRPAG---TRSVRAPVT-KVHGGAGSA---------------- 288

  Fly   370 NYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGK 434
                         :....|.||.|.::|  :...|.|:..|..||.|.||.:||:.|.::.::|:
Mouse   289 -------------QRMPLCDKCGSGIVG--AVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGE 338

  Fly   435 PYCE 438
            .|||
Mouse   339 LYCE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 20/51 (39%)
LIM2_LPP 448..507 CDD:188740
LIM3_LPP 508..575 CDD:188821
Pdlim3NP_001361581.1 PDZ_signaling 2..80 CDD:238492
DUF4749 184..268 CDD:374237 19/87 (22%)
LIM_ALP 294..346 CDD:188834 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.