DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fhl3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001008165.1 Gene:fhl3 / 493527 XenbaseID:XB-GENE-947662 Length:279 Species:Xenopus tropicalis


Alignment Length:250 Identity:64/250 - (25%)
Similarity:107/250 - (42%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 SNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYISIPTEPV----QEL--------ENYGR 387
            :|:.:..:.|..| :.|..:|:....|.:.....:...|:..||.    :||        |...:
 Frog    37 ANTCDECKELIGH-DCRELYYEDRHYHEHCFRCFRCDHSLADEPFTCQDEELLCNDCYCNEFSSK 100

  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVC 451
            |:.|...|:..|.......|.:|..||.|..||..:..:.|...:...||...|...| .:|:.|
 Frog   101 CISCEKTVMPGSRKLEYNGQTWHEHCFICNSCQQPIGSRSFIPENQNHYCIPCYESKLAPRCTHC 165

  Fly   452 MEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIM 516
            .:.:.:..:....:|:|.:||.|..|...|.|..|| ....:.|||..|...:|.:|..|.:||.
 Frog   166 KKSLTKGGVTYRDEPWHKECFVCTGCKTQLAGQQFT-SQDEKPYCIKCFGNLYAKKCAGCTKPIT 229

  Fly   517 PDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNA 571
            ...|.:   .|...:|.:|..|:.|..|    |:...|:|..|.::.:||::||:
 Frog   230 GFGGAK---YVSFEERHWHHSCFNCSRC----STSLVGKGFIPDNEDILCRACNS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 17/58 (29%)
LIM3_LPP 508..575 CDD:188821 19/63 (30%)
fhl3NP_001008165.1 LIM <5..33 CDD:351770
LIM1_FHL3 36..94 CDD:188807 11/57 (19%)
LIM2_FHL3 98..155 CDD:188811 14/56 (25%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM4_FHL3 221..276 CDD:188818 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.