DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and AgaP_AGAP005398

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_001237656.2 Gene:AgaP_AGAP005398 / 4576421 VectorBaseID:AGAP005398 Length:308 Species:Anopheles gambiae


Alignment Length:273 Identity:53/273 - (19%)
Similarity:101/273 - (36%) Gaps:54/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 IYEPINPRPCVADTLPRESYNLHNSYVNDNNPNISHEYNISNS-IEANQTLY------IHGNAR- 351
            :|..|..:.|.....|||::.:::..:......:..:::.:.| ::..|..|      |..:|: 
Mosquito    46 LYNLIVRKTCQECKCPRETHAVYHEQLTTVRERLGFKHDTNTSRVDPRQMGYTWVPPGILTSAKI 110

  Fly   352 TTFYDVNSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTC 416
            ..::||                ||.|.|.::...|...:....|........|:|...|:     
Mosquito   111 QRYFDV----------------IPPEKVPKIGTQGERFRDKQLVYQLPKQDLALDYCKHV----- 154

  Fly   417 TDCQINLQGKPFYALDGKPYCEYDYLQTL---EKCSVCMEPILERILRATGKPY------HPQCF 472
             :.|.....:.|.|...:...:..|::..   .||:.|.:.:.:..:..|...:      ||:||
Mosquito   155 -EEQHRGSYEDFVAARNEIALDIGYVKDTPLSTKCTGCSDTLNQGEMAVTAPKFREQTLWHPRCF 218

  Fly   473 TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLE 537
            .|..|.:.|..|.:.|. .:|.||...:.:...|||..|.:...|.|             :|...
Mosquito   219 KCTTCDELLVDLTYCVH-DDQIYCERHYAEMLKPRCSACDEVGAPFP-------------TFPSG 269

  Fly   538 C-YKCEDCGLLLS 549
            | |..:.||:.::
Mosquito   270 CAYNMQYCGIAIN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 7/52 (13%)
LIM2_LPP 448..507 CDD:188740 15/64 (23%)
LIM3_LPP 508..575 CDD:188821 9/43 (21%)
AgaP_AGAP005398XP_001237656.2 PET_LIMPETin_LIM-9 95..178 CDD:193605 17/104 (16%)
LIM1_LIMPETin 188..245 CDD:188798 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.