DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fhl5

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001004112.1 Gene:fhl5 / 445475 ZFINID:ZDB-GENE-040822-3 Length:280 Species:Danio rerio


Alignment Length:240 Identity:68/240 - (28%)
Similarity:92/240 - (38%) Gaps:51/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 KNYISIPTEPVQELENYGRCVKCNSRVLGESS-------GCTAMDQIY-----HIFCFTCTDCQI 421
            |.||      ::|...|  |.||...:.....       ||...|..|     |..||.|..|..
Zfish    18 KKYI------LKEDTQY--CTKCYENLFANCCEVCSLPIGCNCKDLSYKDRHWHENCFKCAKCSR 74

  Fly   422 NLQGKPFYALDGKPYC------EYDYLQTLEKCSVCMEPIL--ERILRATGKPYHPQCFTCVVCG 478
            :|..|||.|.|....|      ||.     .|||.|.:.::  .|.:...|..:|..||.|..|.
Zfish    75 SLVDKPFAAKDELMLCTECYSHEYS-----SKCSTCKKTVMPGSRKMEYKGNSWHETCFLCQRCQ 134

  Fly   479 KSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCED 543
            :.: |....:...|..:|:..|.|:||.:||.||:.|       .|..|...|:.:|.||:.|..
Zfish   135 QPI-GTKSFIPKDNNYFCVPCFEKQFAYQCCACKKAI-------TTGGVTYHDKPWHRECFTCIG 191

  Fly   544 CGLLLSSEA-EGRGCYPLDDHVLCKSC----NAKRVQALTNRMTS 583
            |...|:.:. ..|..||     .|..|    .||:....|..:||
Zfish   192 CKRQLAGQRFTSRENYP-----YCLDCFSNLYAKKCVGCTKAITS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 21/70 (30%)
LIM2_LPP 448..507 CDD:188740 17/60 (28%)
LIM3_LPP 508..575 CDD:188821 21/71 (30%)
fhl5NP_001004112.1 LIM <6..34 CDD:295319 8/23 (35%)
LIM1_FHL 37..95 CDD:188729 16/57 (28%)
LIM 102..158 CDD:295319 14/56 (25%)
LIM3_FHL 163..214 CDD:188732 18/62 (29%)
LIM4_FHL 222..277 CDD:188733 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.