DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fhl2a

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001003732.1 Gene:fhl2a / 445277 ZFINID:ZDB-GENE-040808-49 Length:279 Species:Danio rerio


Alignment Length:241 Identity:69/241 - (28%)
Similarity:97/241 - (40%) Gaps:51/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 KEGL--KNYISIPTEPVQELENYGRCVKCNSRVLGESS-------GCTAMDQIY-----HIFCFT 415
            ||.|  |.|:.....|.        ||||...:...:.       ||.:.|..|     |..||.
Zfish    11 KESLFGKKYVLREDNPY--------CVKCYESLYSNTCEECKKPIGCNSRDLSYKDRHWHEDCFH 67

  Fly   416 CTDCQINLQGKPFYALDGKPYC------EYDYLQTLEKCSVCMEPIL--ERILRATGKPYHPQCF 472
            |..|:.:|..|||...|.:..|      ||.     .||..|.:.|:  .|.:...|..:|..||
Zfish    68 CFQCKRSLVDKPFSTKDEQLLCTECYSNEYS-----SKCHECKKTIMPGSRKMEHKGNSWHETCF 127

  Fly   473 TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLE 537
            ||..|.:.: |....:...|.|||:..:.|:||.:|..||:||       .|..|...|:.:|.:
Zfish   128 TCQRCQQPI-GTKSFIPKDNHNYCVPCYEKQFAMQCVHCKKPI-------TTGGVTYHDQPWHKD 184

  Fly   538 CYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSC----NAKRVQALTN 579
            |:.|..|...||    |:.....||...|.:|    .||:..:.|:
Zfish   185 CFLCTGCKQQLS----GQRFTSRDDFAYCLNCFCNLYAKKCASCTS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 21/70 (30%)
LIM2_LPP 448..507 CDD:188740 19/60 (32%)
LIM3_LPP 508..575 CDD:188821 21/70 (30%)
fhl2aNP_001003732.1 LIM <7..33 CDD:295319 10/29 (34%)
LIM1_FHL2 36..97 CDD:188806 15/60 (25%)
LIM2_FHL2 101..157 CDD:188810 16/56 (29%)
LIM3_Fhl2 162..218 CDD:188815 19/66 (29%)
LIM 221..278 CDD:295319 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.