DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and fhl1a

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:239 Identity:68/239 - (28%)
Similarity:104/239 - (43%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 DVNSIHRNDKEG----LKNYISIPTEPVQELENYGR--CVKCNSR-----------VLGESSGCT 403
            ::|..:|:..||    .|.|..:..||.|..:: |:  |.||..|           |:  :.||.
Zfish    69 ELNHKNRHWHEGCFRCAKCYKPLANEPFQAKDD-GKIMCGKCGDRDGSPRCQGCYKVI--TPGCK 130

  Fly   404 AMD---QIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK-CSVCMEPILERILRATG 464
            .::   :::|..||||.:|:..::.:.|.......||...:.:...| |..|.|.|....|....
Zfish   131 NVEYKHKVWHEECFTCFECKQPIRTQSFLTKGDDMYCTPCHEKKFAKHCVRCKEAITSGGLTYQD 195

  Fly   465 KPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVA 529
            :|:|.:||.|..|.|.|.|..||.. .:|.||:..:....|.:|..|:.||   .|......||.
Zfish   196 QPWHSECFVCHTCKKPLAGARFTAH-EDQFYCVDCYKSDVAKKCSGCQNPI---TGFGRGTNVVN 256

  Fly   530 L-DRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAK 572
            . |:|:|..|:.|:.|.|   |.|..|.....:| :.|..|..|
Zfish   257 YEDKSWHEYCFNCKKCSL---SMAHKRFVINGED-IYCSDCAKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 16/66 (24%)
LIM2_LPP 448..507 CDD:188740 20/58 (34%)
LIM3_LPP 508..575 CDD:188821 21/66 (32%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319
LIM1_FHL1 56..110 CDD:188730 12/41 (29%)
LIM2_FHL1 118..175 CDD:188808 12/58 (21%)
LIM3_FHL1 179..231 CDD:188813 19/52 (37%)
LIM4_FHL1 234..297 CDD:188734 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.