DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LIMS1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001358423.1 Gene:LIMS1 / 3987 HGNCID:6616 Length:398 Species:Homo sapiens


Alignment Length:318 Identity:73/318 - (22%)
Similarity:121/318 - (38%) Gaps:81/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 RPCVA---DTLPRESYNLHNSYVNDNNPNISHEYNISNSIEANQTLY-IHGNART-----TFYDV 357
            |||:.   :.:||.:.            |..||.|.:....|...|. .|.:.:.     .||  
Human     8 RPCIIPENEEIPRAAL------------NTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFY-- 58

  Fly   358 NSIHRNDKEGLKNYISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQIN 422
                  .|..:.|.::..|           |.:|............:..::||..||.|..|...
Human    59 ------AKFNMANALASAT-----------CERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQ 106

  Fly   423 LQGKPFYALDGKPYCEYDYLQTLEK-CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLF 486
            .....||..:|:.|||:|:...... |..|.|.|:.|:::|....:||:||.|.:|.:.|..:.|
Human   107 FPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGF 171

  Fly   487 TVDATNQNYCITDFHKKFAPR------CCVC-----KQPIM--PDPGQEETIRVVALDRSFHLEC 538
            ..:| .::.| ...|.:...|      |..|     :||::  .||              :|.:.
Human   172 VKNA-GRHLC-RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDP--------------YHPDH 220

  Fly   539 YKCEDCGLLLSSEA-EGRG---CYPLDDHV---LCKSC----NAKRVQALTNRMTSEH 585
            :.|.:||..|:::| |.:|   |.|..|.:   :|.:|    ..:.|.|:..:...||
Human   221 FNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 17/58 (29%)
LIM3_LPP 508..575 CDD:188821 19/84 (23%)
LIMS1NP_001358423.1 LIM1_PINCH 72..130 CDD:188717 15/57 (26%)
LIM2_PINCH 133..184 CDD:188718 16/52 (31%)
LIM3_PINCH 197..247 CDD:188719 16/63 (25%)
LIM4_PINCH 253..306 CDD:188720 6/26 (23%)
LIM5_PINCH 314..367 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.