DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LIMK2

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001026971.1 Gene:LIMK2 / 3985 HGNCID:6614 Length:686 Species:Homo sapiens


Alignment Length:85 Identity:28/85 - (32%)
Similarity:39/85 - (45%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 FTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVCMEPILERILRATGKPYHPQCFTCVVC 477
            |.|::||.:|... :|..|||.||..||.... |.|..|...:....:.|....|||:||.|:.|
Human    17 FRCSECQDSLTNW-YYEKDGKLYCPKDYW
GKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSC 80

  Fly   478 GKSL-DGLLFTVDATNQNYC 496
            ...: ||..:.:......||
Human    81 KVIIEDGDAYALVQHATLYC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 11/26 (42%)
LIM2_LPP 448..507 CDD:188740 14/50 (28%)
LIM3_LPP 508..575 CDD:188821
LIMK2NP_001026971.1 LIM <15..44 CDD:295319 12/27 (44%)
LIM2_LIMK2 46..104 CDD:188849 15/55 (27%)
PDZ 131..215 CDD:278991
PKc_like 316..570 CDD:328722
PP1_inhibitor 564..686 CDD:283108
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.