DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LIMK1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_002305.1 Gene:LIMK1 / 3984 HGNCID:6613 Length:647 Species:Homo sapiens


Alignment Length:154 Identity:47/154 - (30%)
Similarity:78/154 - (50%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVC 451
            |..|..|:. :.....|::..:|..||.|.||..:|..: :|..||:.:|:.||.... |.|..|
Human    25 CASCGQRIY-DGQYLQALNADWHADCFRCCDCSASLSHQ-YYEKDGQLFCKKDYWARYGESCHGC 87

  Fly   452 MEPILERILRATGK-PYHPQCFTCVVCGKSL-DGLLFTVDATNQNYCITDFHKKFAPRCCVCKQP 514
            .|.|.:.::...|: .|||:||.|:.||..: ||..:|:...::.||...:::.....  |.:| 
Human    88 SEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTP--VIEQ- 149

  Fly   515 IMPD-PGQE--ETIRVVALDRSFH 535
            |:|| ||..  .|:.:|::..|.|
Human   150 ILPDSPGSHLPHTVTLVSIPASSH 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 18/60 (30%)
LIM3_LPP 508..575 CDD:188821 11/31 (35%)
LIMK1NP_002305.1 LIM1_LIMK1 5..77 CDD:188846 16/53 (30%)
LIM 84..138 CDD:295319 18/53 (34%)
PDZ 165..255 CDD:278991 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..319
STKc_LIMK1 345..611 CDD:271123
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.