DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and lmcd1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_957364.2 Gene:lmcd1 / 394045 ZFINID:ZDB-GENE-040426-1067 Length:342 Species:Danio rerio


Alignment Length:313 Identity:73/313 - (23%)
Similarity:116/313 - (37%) Gaps:80/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 FISDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPIDYLQNNQ-TTNPLQIYANQYAMQHDAT 285
            |||:|| |:|   ........|.|:.|.......:....|.:|.. .|||:       ..:.|.|
Zfish    45 FISNNE-DDL---KVGRLLADSRYTHLTAKVKGGDGTRVYKRNRMIVTNPV-------VSRKDPT 98

  Fly   286 GKSSSTYD-----------SIYEPINP---RPCVADT---LPRESYNLHNSYVNDNNPNISHEYN 333
             .::.|||           .:|..:.|   || ||.|   |.|...........|::|...|..:
Zfish    99 -FNTVTYDWAPTGLTQKLAMLYMSLLPEERRP-VAGTEGSLYRHKQLTRQLPAYDHDPAYCHSLS 161

  Fly   334 ------ISNSIEANQ-------TLYIHGNARTTFYDVNSIHRNDKEGLKNYISIPTEPVQELENY 385
                  ::..:::.:       .:.:.|...||       .||:|...:.    |..|:.|....
Zfish   162 EAELKVMAQFVKSYKEESLGVGEVALPGEKSTT-------KRNEKISQEQ----PDPPLTEQTPD 215

  Fly   386 GRCVKCNSRVLGES----SGC---TAMDQ------------IYHIFCFTCTDCQINLQGKPFYAL 431
            |   ...|.|..|:    |||   .|||:            ::|..||.|.:|...|....::..
Zfish   216 G---AIESPVSNETEYYCSGCGQLAAMDEPVVYADRAGYERLWHPACFVCGECGEALVDLIYFWK 277

  Fly   432 DGKPYCEYDYLQTLE-KCSVCMEPILERIL--RATGKPYHPQCFTCVVCGKSL 481
            :|...|...|.|::. :|..|.|.|...:|  .|:|..:|.:.|.|.:||:.:
Zfish   278 EGALLCGRHYCQSIRPRCLGCDELIFSDMLLQEASGHVWHKEHFCCWLCGQDI 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/71 (24%)
LIM2_LPP 448..507 CDD:188740 12/36 (33%)
LIM3_LPP 508..575 CDD:188821
lmcd1NP_957364.2 PET_testin 102..189 CDD:193604 15/87 (17%)
LIM1_Testin_like 230..287 CDD:188726 14/56 (25%)
LIM 293..>326 CDD:295319 10/32 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.