DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Wtip

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_008757482.2 Gene:Wtip / 361552 RGDID:1306411 Length:397 Species:Rattus norvegicus


Alignment Length:233 Identity:105/233 - (45%)
Similarity:136/233 - (58%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SIPTEP----------------VQELEN----------YGRCVKCNSRVLGESSGCTAMDQIYHI 411
            |:|..|                .:|||.          :|.|:||...:.|....|.||..:||.
  Rat   151 SLPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKCGLGIYGARQACQAMGSLYHT 215

  Fly   412 FCFTCTDCQINLQGKPFYALDGKPYCEYDYL-----QTLEKCSVCMEPILERILRATGKPYHPQC 471
            .||.|..|...|:||.||.:..|.||:.|:|     ||.:|||||...|:|.||:|.||.|||.|
  Rat   216 DCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGC 280

  Fly   472 FTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHL 536
            |.|.||.:.|||:.||||..|..||:.|:|..|||:|..|.:||:|..|.|.|||||::||.:|:
  Rat   281 FRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHV 345

  Fly   537 ECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRV 574
            |||.|||||:.||.| |||.||||:.|:||:.|:.:|:
  Rat   346 ECYHCEDCGMQLSGE-EGRRCYPLEGHLLCRRCHLRRL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 21/52 (40%)
LIM2_LPP 448..507 CDD:188740 33/58 (57%)
LIM3_LPP 508..575 CDD:188821 38/67 (57%)
WtipXP_008757482.2 PRK07003 <23..>185 CDD:235906 6/33 (18%)
LIM1_Ajuba_like 192..245 CDD:188738 21/52 (40%)
LIM2_Ajuba_like 257..309 CDD:188741 29/51 (57%)
LIM3_Ajuba_like 317..378 CDD:188822 36/61 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.