DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Tesl

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001107222.1 Gene:Tesl / 316142 RGDID:1305365 Length:406 Species:Rattus norvegicus


Alignment Length:345 Identity:80/345 - (23%)
Similarity:137/345 - (39%) Gaps:63/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 NQYAMQHDATGKSSSTYDSIYE---PINPRPCVADTLPRESYNLHNSY--------------VND 323
            |..||.:..|.:........||   |:..:....:.:.:|..:|..|:              .:|
  Rat    81 NVMAMTNPCTAEKKFFNTGSYEWAPPVQRQELARNYMAKEKLSLSGSWATQYLKKQLSKQLPAHD 145

  Fly   324 NNPNISHEYNISNSIEANQTLYIHGN------ARTTFYDVNSIHRNDK----EGLKNYISI---- 374
            .:|:..||.:.:...|..|.:..:.|      |.....:||.  :.||    ..::|..|.    
  Rat   146 QDPSKCHELSPNEVREMEQFIKKYKNEALGVGAMKHLSEVND--QGDKVQNPARVRNTTSALSSK 208

  Fly   375 --PTEPVQELENYGRCVKCNSRVLGESSGCTAM-------DQIYHIFCFTCTDCQINLQGKPFYA 430
              .|||  :...|. |..|...:   ..|.||:       ::::|..||.|:.|...|....::.
  Rat   209 EKSTEP--KKTQYS-CYCCKQPI---KEGDTAIYAERAGYNKLWHPSCFICSTCGELLVHMIYFW 267

  Fly   431 LDGKPYCEYDYLQTLE-KCSVCMEPILER-ILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQ 493
            .:||.||...|..:.: :|:.|.|.|..: ..:|..:.:|.:.|:|..|.|.|.|.:: |...::
  Rat   268 KNGKLYCGRHYCDSEKPRCAGCDELIFSKEYTQAENQNWHLKHFSCFDCDKILAGKIY-VMVNDK 331

  Fly   494 NYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHL--ECYKCEDCGLLLSSEAEGRG 556
            ..|...:.|..|.:|..|:..|.|     |..||...:.|:|.  ||:.|..|...|.    |:.
  Rat   332 PVCKPCYMKNHAVKCQECQSVIDP-----ELQRVTYNNFSWHASSECFLCSCCRKCLF----GQK 387

  Fly   557 CYPLDDHVLCKSCNAKRVQA 576
            ..|::..|.| |...|::.:
  Rat   388 FMPVNGLVFC-SMECKKMMS 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/59 (25%)
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 20/68 (29%)
TeslNP_001107222.1 PET_testin 101..183 CDD:193604 14/81 (17%)
LIM1_Testin 221..278 CDD:188797 15/59 (25%)
LIM2_Testin 284..339 CDD:188800 14/55 (25%)
LIM 346..404 CDD:295319 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.