Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106208.1 | Gene: | Limd1 / 316101 | RGDID: | 1309830 | Length: | 663 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 98/196 - (50%) |
---|---|---|---|
Similarity: | 134/196 - (68%) | Gaps: | 6/196 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 YGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-----QT 444
Fly 445 LEKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCC 509
Fly 510 VCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRV 574
Fly 575 Q 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 25/52 (48%) |
LIM2_LPP | 448..507 | CDD:188740 | 30/58 (52%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 38/66 (58%) | ||
Limd1 | NP_001106208.1 | Mediates nuclear export. /evidence=ECO:0000250 | 54..128 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 74..99 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 117..158 | ||||
Interaction with EGLN1/PHD2. /evidence=ECO:0000250 | 180..251 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 230..253 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 267..297 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 335..416 | ||||
Interaction with RB1. /evidence=ECO:0000250 | 391..429 | ||||
Necessary for nuclear localization. /evidence=ECO:0000250 | 459..663 | 97/193 (50%) | |||
LIM1_Ajuba_like | 459..512 | CDD:188738 | 25/52 (48%) | ||
LIM2_Ajuba_like | 524..576 | CDD:188741 | 26/51 (51%) | ||
LIM3_Ajuba_like | 584..645 | CDD:188822 | 35/61 (57%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |