DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Prickle2

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_038963548.1 Gene:Prickle2 / 312563 RGDID:1306723 Length:939 Species:Rattus norvegicus


Alignment Length:365 Identity:84/365 - (23%)
Similarity:126/365 - (34%) Gaps:105/365 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LEFNKPIDYL----QNNQTTNPLQIYANQYAMQHDATGKSSSTYDSIYEPINPR------PCVAD 307
            ||..|.|..|    |.|.|::             |.:|.:...|..:...:.|.      .|   
  Rat    99 LEMEKTISKLMFDFQRNSTSD-------------DDSGCALEEYAWVPPGLKPEQVHQYYSC--- 147

  Fly   308 TLPRESYNLHNSYVNDNNPNI----------SHEYNISNSIEANQTLYIHGNARTTFYDVNSIHR 362
             ||.|..    .|||.....:          .|:         |:..|           .||:..
  Rat   148 -LPEEKV----PYVNSPGEKLRIKQLLHQLPPHD---------NEVRY-----------CNSLDE 187

  Fly   363 NDKEGLKNYISIPTEPVQELENYGR--------------CVKCNSRVLGESSGCTAMDQ----IY 409
            .:|..||.:.:     .::.||.||              |.:|..::.|......|...    .:
  Rat   188 EEKRELKLFSN-----QRKRENLGRGNVRPFPVTMTGAICEQCGGQIKGGDIAVFASRAGHGICW 247

  Fly   410 HIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KCSVCMEPIL-ERILRATGKPYHPQCF 472
            |..||.||.|...|....::..|||.||...:.:.|: :|:.|.|.|. :....|.|:.:|.:.|
  Rat   248 HPPCFICTVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMRHF 312

  Fly   473 TCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALD-RSFHL 536
            .|..|...|.|..: :....:.||...|...:|..|..|.|.|..|.||      :..| :.:|.
  Rat   313 CCFECETVLGGQRY-IMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQ------MTYDGQHWHA 370

  Fly   537 --ECYKCEDC--GLLLSSEAEGRGCYPLDDHVLC-KSCNA 571
              .|:.|..|  .||      ||...|....:.| ::|:|
  Rat   371 TENCFCCAHCKKSLL------GRPFLPKQGQIFCSRACSA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 16/56 (29%)
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 20/70 (29%)
Prickle2XP_038963548.1 PET_Prickle 118..214 CDD:193602 23/141 (16%)
LIM1_Prickle 222..280 CDD:188799 16/57 (28%)
LIM2_Prickle 285..340 CDD:188802 14/55 (25%)
LIM3_Prickle 345..403 CDD:188804 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.