DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Ablim3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001178627.1 Gene:Ablim3 / 307395 RGDID:1565118 Length:683 Species:Rattus norvegicus


Alignment Length:217 Identity:60/217 - (27%)
Similarity:96/217 - (44%) Gaps:26/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 YISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKP 435
            |...|..| :...|..:|.:|.....||.  ....:..:||.||||..|...|....|:..:.:.
  Rat     7 YQQSPYSP-RGSSNVIQCYRCGDTCKGEV--VRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEY 68

  Fly   436 YCEYDYLQTL-EKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSL---DGLLFT-----VDAT 491
            .|..||.|.. .:|..|.:.|...::.|.|:.|||:||.|.:|.|..   |.:.|:     ....
  Rat    69 ICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTC 133

  Fly   492 NQNYCITDFHKKFAP-RCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGR 555
            :|:...:...|...| .|..||:.|  ..||.    ::|||:.:|:.|:||:.|.::|:.|...:
  Rat   134 SQSMTSSKPIKIRGPSHCAGCKEEI--KHGQS----LLALDKQWHVSCFKCQTCSVILTGEYISK 192

  Fly   556 GCYPL---DDH----VLCKSCN 570
            ...|.   |.|    :.|::|:
  Rat   193 DGVPYCESDYHAQFGIKCETCD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 18/67 (27%)
LIM3_LPP 508..575 CDD:188821 21/70 (30%)
Ablim3NP_001178627.1 LIM1_abLIM 23..74 CDD:188713 14/52 (27%)
LIM2_abLIM 79..134 CDD:188714 15/54 (28%)
LIM3_abLIM 151..202 CDD:188715 17/56 (30%)
LIM4_abLIM 210..265 CDD:188716 2/5 (40%)
AbLIM_anchor 274..647 CDD:292800
VHP 648..683 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.