Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001178627.1 | Gene: | Ablim3 / 307395 | RGDID: | 1565118 | Length: | 683 | Species: | Rattus norvegicus |
Alignment Length: | 217 | Identity: | 60/217 - (27%) |
---|---|---|---|
Similarity: | 96/217 - (44%) | Gaps: | 26/217 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 YISIPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKP 435
Fly 436 YCEYDYLQTL-EKCSVCMEPILERILRATGKPYHPQCFTCVVCGKSL---DGLLFT-----VDAT 491
Fly 492 NQNYCITDFHKKFAP-RCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGR 555
Fly 556 GCYPL---DDH----VLCKSCN 570 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 14/52 (27%) |
LIM2_LPP | 448..507 | CDD:188740 | 18/67 (27%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 21/70 (30%) | ||
Ablim3 | NP_001178627.1 | LIM1_abLIM | 23..74 | CDD:188713 | 14/52 (27%) |
LIM2_abLIM | 79..134 | CDD:188714 | 15/54 (28%) | ||
LIM3_abLIM | 151..202 | CDD:188715 | 17/56 (30%) | ||
LIM4_abLIM | 210..265 | CDD:188716 | 2/5 (40%) | ||
AbLIM_anchor | 274..647 | CDD:292800 | |||
VHP | 648..683 | CDD:128458 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |